Lineage for d1g01a1 (1g01 A:228-579)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Alkaline cellulase K catalytic domain [63906] (1 species) Species Bacillus sp. [TaxId:1409] [63907] (2 PDB entries) 
Domain d1g01a1: 1g01 A:228-579 [60161]
Other proteins in same PDB: d1g01a2
complexed with acy, cd
Details for d1g01a1
PDB Entry: 1g01 (more details), 1.9 Å
PDB Description: alkaline cellulase k catalytic domain
PDB Compounds: (A:) endoglucanaseSCOPe Domain Sequences for d1g01a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g01a1 c.1.8.3 (A:228-579) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]}
avkspseagalqlvelngqltlagedgtpvqlrgmsthglqwfgeivnenafvalsndwg
snmirlamyigengyatnpevkdlvyegielafehdmyvivdwhvhapgdpradvysgay
dffeeiadhykdhpknhyiiwelanepspnnnggpgltndekgweavkeyaepivemlre
kgdnmilvgnpnwsqrpdlsadnpidaenimysvhfytgshgashigypegtpssersnv
manvryaldngvavfatewgtsqangdggpyfdeadvwlnflnkhniswanwsltnknei
sgaftpfelgrtdatdldpganqvwapeelslsgeyvrarikgieytpidrt
SCOPe Domain Coordinates for d1g01a1:
Click to download the PDB-style file with coordinates for d1g01a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g01a1:
- d1g01a1 first appeared in SCOP 1.57, called d1g01a_
- d1g01a1 appears in SCOPe 2.07
View in 3D
