Lineage for d1fzvb_ (1fzv B:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623356Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 623357Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 623358Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 623359Protein Placenta growth factor-1, PLGF-1 [64560] (1 species)
  7. 623360Species Human (Homo sapiens) [TaxId:9606] [64561] (2 PDB entries)
  8. 623362Domain d1fzvb_: 1fzv B: [60160]
    complexed with mpd

Details for d1fzvb_

PDB Entry: 1fzv (more details), 2 Å

PDB Description: the crystal structure of human placenta growth factor-1 (plgf-1), an angiogenic protein at 2.0a resolution

SCOP Domain Sequences for d1fzvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzvb_ g.17.1.1 (B:) Placenta growth factor-1, PLGF-1 {Human (Homo sapiens)}
ssevevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhc
vpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplr

SCOP Domain Coordinates for d1fzvb_:

Click to download the PDB-style file with coordinates for d1fzvb_.
(The format of our PDB-style files is described here.)

Timeline for d1fzvb_: