SCOPe 2.08: Domain d1fzvb_: 1fzv B:

Lineage for d1fzvb_ (1fzv B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein Placenta growth factor-1, PLGF-1 [64560] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64561] (2 PDB entries)

8. Domain d1fzvb_: 1fzv B: [60160]
   complexed with mpd

Details for d1fzvb_

PDB Entry: 1fzv, 2 Å

PDB Description: the crystal structure of human placenta growth factor-1 (plgf-1), an angiogenic protein at 2.0a resolution

PDB Compounds: (B:) placenta growth factor

SCOPe Domain Sequences for d1fzvb_:

Sequence; same for both SEQRES and ATOM records:

>d1fzvb_ g.17.1.1 (B:) Placenta growth factor-1, PLGF-1 {Human (Homo sapiens) [TaxId: 9606]}
ssevevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhc
vpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplr

Timeline for d1fzvb_:

• d1fzvb_ first appeared in SCOP 1.57
  
• d1fzvb_ appears in SCOPe 2.07