Lineage for d1fzva_ (1fzv A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749103Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 749104Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 749105Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 749106Protein Placenta growth factor-1, PLGF-1 [64560] (1 species)
  7. 749107Species Human (Homo sapiens) [TaxId:9606] [64561] (2 PDB entries)
  8. 749108Domain d1fzva_: 1fzv A: [60159]

Details for d1fzva_

PDB Entry: 1fzv (more details), 2 Å

PDB Description: the crystal structure of human placenta growth factor-1 (plgf-1), an angiogenic protein at 2.0a resolution
PDB Compounds: (A:) placenta growth factor

SCOP Domain Sequences for d1fzva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzva_ g.17.1.1 (A:) Placenta growth factor-1, PLGF-1 {Human (Homo sapiens) [TaxId: 9606]}
ssevevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhc
vpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplr

SCOP Domain Coordinates for d1fzva_:

Click to download the PDB-style file with coordinates for d1fzva_.
(The format of our PDB-style files is described here.)

Timeline for d1fzva_: