SCOPe 2.05: Domain d1fzta_: 1fzt A:

Lineage for d1fzta_ (1fzt A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein Phosphoglycerate mutase [53256] (6 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [64109] (1 PDB entry)

8. Domain d1fzta_: 1fzt A: [60158]

Details for d1fzta_

PDB Entry: 1fzt

PDB Description: solution structure and dynamics of an open b-sheet, glycolytic enzyme- monomeric 23.7 kda phosphoglycerate mutase from schizosaccharomyces pombe

PDB Compounds: (A:) phosphoglycerate mutase

SCOPe Domain Sequences for d1fzta_:

Sequence; same for both SEQRES and ATOM records:

>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mtteaapnllvltrhgesewnklnlftgwkdpalsetgikeaklggerlksrgykfdiaf
tsalqraqktcqiileevgepnletikseklneryygdlqglnkddarkkwgaeqvqiwr
rsydiappngeslkdtaervlpyykstivphilkgekvliaahgnslralimdlegltgd
qivkrelatgvpivyhldkdgkyvskelidn

Timeline for d1fzta_:

• d1fzta_ first appeared in SCOP 1.57
  
• d1fzta_ appears in SCOPe 2.04
  
• d1fzta_ appears in SCOPe 2.06
  
• d1fzta_ appears in the current release, SCOPe 2.08