Lineage for d1fzta_ (1fzt A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183050Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 183051Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 183052Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins)
  6. 183058Protein Phosphoglycerate mutase [53256] (3 species)
  7. 183086Species Yeast (Schizosaccharomyces pombe) [64109] (1 PDB entry)
  8. 183087Domain d1fzta_: 1fzt A: [60158]

Details for d1fzta_

PDB Entry: 1fzt (more details)

PDB Description: solution structure and dynamics of an open b-sheet, glycolytic enzyme- monomeric 23.7 kda phosphoglycerate mutase from schizosaccharomyces pombe

SCOP Domain Sequences for d1fzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Yeast (Schizosaccharomyces pombe)}
mtteaapnllvltrhgesewnklnlftgwkdpalsetgikeaklggerlksrgykfdiaf
tsalqraqktcqiileevgepnletikseklneryygdlqglnkddarkkwgaeqvqiwr
rsydiappngeslkdtaervlpyykstivphilkgekvliaahgnslralimdlegltgd
qivkrelatgvpivyhldkdgkyvskelidn

SCOP Domain Coordinates for d1fzta_:

Click to download the PDB-style file with coordinates for d1fzta_.
(The format of our PDB-style files is described here.)

Timeline for d1fzta_: