Lineage for d1fzta_ (1fzt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2890977Protein Phosphoglycerate mutase [53256] (6 species)
  7. 2891006Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [64109] (1 PDB entry)
  8. 2891007Domain d1fzta_: 1fzt A: [60158]

Details for d1fzta_

PDB Entry: 1fzt (more details)

PDB Description: solution structure and dynamics of an open b-sheet, glycolytic enzyme- monomeric 23.7 kda phosphoglycerate mutase from schizosaccharomyces pombe
PDB Compounds: (A:) phosphoglycerate mutase

SCOPe Domain Sequences for d1fzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mtteaapnllvltrhgesewnklnlftgwkdpalsetgikeaklggerlksrgykfdiaf
tsalqraqktcqiileevgepnletikseklneryygdlqglnkddarkkwgaeqvqiwr
rsydiappngeslkdtaervlpyykstivphilkgekvliaahgnslralimdlegltgd
qivkrelatgvpivyhldkdgkyvskelidn

SCOPe Domain Coordinates for d1fzta_:

Click to download the PDB-style file with coordinates for d1fzta_.
(The format of our PDB-style files is described here.)

Timeline for d1fzta_: