SCOP 1.69: Domain d1fzob_: 1fzo B:

Lineage for d1fzob_ (1fzo B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (60 PDB entries)

8. Domain d1fzob_: 1fzo B: [60157]
   Other proteins in same PDB: d1fzoa1, d1fzoa2

Details for d1fzob_

PDB Entry: 1fzo, 1.8 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein

SCOP Domain Sequences for d1fzob_:

Sequence; same for both SEQRES and ATOM records:

>d1fzob_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1fzob_:

• d1fzob_ first appeared in SCOP 1.57, called d1fzob1
  
• d1fzob_ appears in SCOP 1.67
  
• d1fzob_ appears in SCOP 1.71
  
• d1fzob_ appears in the current release, SCOPe 2.08