Lineage for d1fzoa2 (1fzo A:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856645Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
    Uniprot P01901 22-299
  8. 856653Domain d1fzoa2: 1fzo A:1-181 [60156]
    Other proteins in same PDB: d1fzoa1, d1fzob_
    complexed with fuc, mpd, nag, po4; mutant

Details for d1fzoa2

PDB Entry: 1fzo (more details), 1.8 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOP Domain Sequences for d1fzoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzoa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1fzoa2:

Click to download the PDB-style file with coordinates for d1fzoa2.
(The format of our PDB-style files is described here.)

Timeline for d1fzoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fzoa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fzob_