![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species) |
![]() | Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries) |
![]() | Domain d1fzoa2: 1fzo A:1-181 [60156] Other proteins in same PDB: d1fzoa1, d1fzob_ complexed with fuc, mpd, nag, po4; mutant |
PDB Entry: 1fzo (more details), 1.8 Å
SCOP Domain Sequences for d1fzoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzoa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB} gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d1fzoa2: