Lineage for d1fzma2 (1fzm A:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719653Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
  8. 719661Domain d1fzma2: 1fzm A:1-181 [60153]
    Other proteins in same PDB: d1fzma1, d1fzmb_
    complexed with fuc, mpd, nag, po4; mutant

Details for d1fzma2

PDB Entry: 1fzm (more details), 1.8 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOP Domain Sequences for d1fzma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzma2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1fzma2:

Click to download the PDB-style file with coordinates for d1fzma2.
(The format of our PDB-style files is described here.)

Timeline for d1fzma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fzma1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fzmb_