SCOPe 2.01: Domain d1fzka2: 1fzk A:1-181

Lineage for d1fzka2 (1fzk A:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
   Uniprot P01901 22-299

8. Domain d1fzka2: 1fzk A:1-181 [60150]
   Other proteins in same PDB: d1fzka1, d1fzkb_
   complexed with mpd, mrd, nag, po4; mutant

Details for d1fzka2

PDB Entry: 1fzk, 1.7 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1fzka2:

Sequence; same for both SEQRES and ATOM records:

>d1fzka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqagaaeyyraylegtcvewlrrylkngnatll
r

Timeline for d1fzka2:

• d1fzka2 first appeared in SCOP 1.57
  
• d1fzka2 appears in SCOP 1.75
  
• d1fzka2 appears in SCOPe 2.02
  
• d1fzka2 appears in the current release, SCOPe 2.08