| Class b: All beta proteins [48724] (111 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
| Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries) |
| Domain d1fzka1: 1fzk A:182-274 [60149] Other proteins in same PDB: d1fzka2 |
PDB Entry: 1fzk (more details), 1.7 Å
SCOP Domain Sequences for d1fzka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzka1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d1fzka1: