Lineage for d1fzjb_ (1fzj B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 783930Protein beta2-microglobulin [88600] (4 species)
  7. 784205Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
    Uniprot P01887
  8. 784214Domain d1fzjb_: 1fzj B: [60148]
    Other proteins in same PDB: d1fzja1, d1fzja2
    complexed with fuc, mpd, nag, po4; mutant

Details for d1fzjb_

PDB Entry: 1fzj (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
PDB Compounds: (B:) Beta-2-microglobulin

SCOP Domain Sequences for d1fzjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzjb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1fzjb_:

Click to download the PDB-style file with coordinates for d1fzjb_.
(The format of our PDB-style files is described here.)

Timeline for d1fzjb_: