SCOP 1.63: Domain d1fzjb_: 1fzj B:

Lineage for d1fzjb_ (1fzj B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)

8. Domain d1fzjb_: 1fzj B: [60148]
   Other proteins in same PDB: d1fzja2
   complexed with fuc, mpd, nag, po4; mutant

Details for d1fzjb_

PDB Entry: 1fzj, 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein

SCOP Domain Sequences for d1fzjb_:

Sequence; same for both SEQRES and ATOM records:

>d1fzjb_ b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1fzjb_:

• d1fzjb_ first appeared in SCOP 1.57, called d1fzjb1
  
• d1fzjb_ was called d1fzjb1 in SCOP 1.61
  
• d1fzjb_ appears in SCOP 1.65
  
• d1fzjb_ appears in the current release, SCOPe 2.08