Lineage for d1fzja2 (1fzj A:1-181)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78661Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 78755Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (15 PDB entries)
  8. 78759Domain d1fzja2: 1fzj A:1-181 [60147]
    Other proteins in same PDB: d1fzja1, d1fzjb1

Details for d1fzja2

PDB Entry: 1fzj (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein

SCOP Domain Sequences for d1fzja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzja2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqagaaeyyraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1fzja2:

Click to download the PDB-style file with coordinates for d1fzja2.
(The format of our PDB-style files is described here.)

Timeline for d1fzja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fzja1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fzjb1