Lineage for d1fzja2 (1fzj A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938107Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2938118Domain d1fzja2: 1fzj A:1-181 [60147]
    Other proteins in same PDB: d1fzja1, d1fzjb_
    complexed with mpd, nag, po4; mutant

Details for d1fzja2

PDB Entry: 1fzj (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1fzja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzja2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqagaaeyyraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1fzja2:

Click to download the PDB-style file with coordinates for d1fzja2.
(The format of our PDB-style files is described here.)

Timeline for d1fzja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fzja1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fzjb_