Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries) |
Domain d1fzja1: 1fzj A:182-274 [60146] Other proteins in same PDB: d1fzja2, d1fzjb_ complexed with fuc, mpd, nag, po4; mutant |
PDB Entry: 1fzj (more details), 1.9 Å
SCOP Domain Sequences for d1fzja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzja1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d1fzja1: