Lineage for d1fzja1 (1fzj A:182-274)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 53093Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (15 PDB entries)
  8. 53100Domain d1fzja1: 1fzj A:182-274 [60146]
    Other proteins in same PDB: d1fzja2

Details for d1fzja1

PDB Entry: 1fzj (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein

SCOP Domain Sequences for d1fzja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzja1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1fzja1:

Click to download the PDB-style file with coordinates for d1fzja1.
(The format of our PDB-style files is described here.)

Timeline for d1fzja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fzja2
View in 3D
Domains from other chains:
(mouse over for more information)
d1fzjb1