SCOP 1.71: Domain d1fzif_: 1fzi F:

Lineage for d1fzif_ (1fzi F:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)

8. Domain d1fzif_: 1fzi F: [60145]
   Other proteins in same PDB: d1fzia_, d1fzib_, d1fzic_, d1fzid_
   complexed with fe, xe

Details for d1fzif_

PDB Entry: 1fzi, 3.3 Å

PDB Description: methane monooxygenase hydroxylase, form i pressurized with xenon gas

SCOP Domain Sequences for d1fzif_:

Sequence; same for both SEQRES and ATOM records:

>d1fzif_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh

Timeline for d1fzif_:

• d1fzif_ first appeared in SCOP 1.57
  
• d1fzif_ appears in SCOP 1.69
  
• d1fzif_ appears in SCOP 1.73
  
• d1fzif_ appears in the current release, SCOPe 2.08