![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies) core: 3 helices; bundle, open |
![]() | Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) ![]() duplication: consists of two domains of this fold |
![]() | Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
![]() | Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
![]() | Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries) |
![]() | Domain d1fzie_: 1fzi E: [60144] Other proteins in same PDB: d1fzia_, d1fzib_, d1fzic_, d1fzid_ |
PDB Entry: 1fzi (more details), 3.3 Å
SCOP Domain Sequences for d1fzie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzie_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus} lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh
Timeline for d1fzie_: