Lineage for d1fzie_ (1fzi E:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies) 
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) 
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries) 
Domain d1fzie_: 1fzi E: [60144]
Other proteins in same PDB: d1fzia_, d1fzib_, d1fzic_, d1fzid_
Details for d1fzie_
PDB Entry: 1fzi (more details), 3.3 Å
PDB Description: methane monooxygenase hydroxylase, form i pressurized with xenon gas
SCOP Domain Sequences for d1fzie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzie_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh
SCOP Domain Coordinates for d1fzie_:
Click to download the PDB-style file with coordinates for d1fzie_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fzie_:
- d1fzie_ first appeared in SCOP 1.57
- d1fzie_ appears in SCOP 1.61
- d1fzie_ appears in the current release, SCOPe 2.08
View in 3D
