Lineage for d1fzic_ (1fzi C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536385Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 536448Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 536449Species Methylococcus capsulatus [TaxId:414] [88793] (15 PDB entries)
  8. 536478Domain d1fzic_: 1fzi C: [60142]
    Other proteins in same PDB: d1fzia_, d1fzib_, d1fzie_, d1fzif_

Details for d1fzic_

PDB Entry: 1fzi (more details), 3.3 Å

PDB Description: methane monooxygenase hydroxylase, form i pressurized with xenon gas

SCOP Domain Sequences for d1fzic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzic_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus}
errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
gysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
dyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1fzic_:

Click to download the PDB-style file with coordinates for d1fzic_.
(The format of our PDB-style files is described here.)

Timeline for d1fzic_: