| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) ![]() duplication: consists of two domains of this fold |
| Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
| Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
| Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries) |
| Domain d1fzhf_: 1fzh F: [60139] Other proteins in same PDB: d1fzha_, d1fzhb_, d1fzhc_, d1fzhd_ complexed with ca, fe, xe |
PDB Entry: 1fzh (more details), 2.6 Å
SCOP Domain Sequences for d1fzhf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzhf_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp
Timeline for d1fzhf_: