Lineage for d1fzhe_ (1fzh E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312626Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2312673Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 2312674Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)
  6. 2312675Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 2312676Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)
  8. 2312721Domain d1fzhe_: 1fzh E: [60138]
    Other proteins in same PDB: d1fzha_, d1fzhb_, d1fzhc_, d1fzhd_
    complexed with ca, fe, xe

Details for d1fzhe_

PDB Entry: 1fzh (more details), 2.6 Å

PDB Description: methane monooxygenase hydroxylase, form ii pressurized with xenon gas
PDB Compounds: (E:) methane monooxygenase component a, gamma chain

SCOPe Domain Sequences for d1fzhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzhe_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlq

SCOPe Domain Coordinates for d1fzhe_:

Click to download the PDB-style file with coordinates for d1fzhe_.
(The format of our PDB-style files is described here.)

Timeline for d1fzhe_: