Lineage for d1fzhe_ (1fzh E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637810Fold a.23: Open three-helical up-and-down bundle [47143] (6 superfamilies)
    core: 3 helices; bundle, open
  4. 637841Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 637842Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 637843Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 637844Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 637891Domain d1fzhe_: 1fzh E: [60138]
    Other proteins in same PDB: d1fzha_, d1fzhb_, d1fzhc_, d1fzhd_

Details for d1fzhe_

PDB Entry: 1fzh (more details), 2.6 Å

PDB Description: methane monooxygenase hydroxylase, form ii pressurized with xenon gas
PDB Compounds: (E:) methane monooxygenase component a, gamma chain

SCOP Domain Sequences for d1fzhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzhe_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlq

SCOP Domain Coordinates for d1fzhe_:

Click to download the PDB-style file with coordinates for d1fzhe_.
(The format of our PDB-style files is described here.)

Timeline for d1fzhe_: