Lineage for d1fzhd_ (1fzh D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990110Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 1990111Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 1990161Domain d1fzhd_: 1fzh D: [60137]
    Other proteins in same PDB: d1fzha_, d1fzhb_, d1fzhe_, d1fzhf_
    complexed with ca, fe, xe

Details for d1fzhd_

PDB Entry: 1fzh (more details), 2.6 Å

PDB Description: methane monooxygenase hydroxylase, form ii pressurized with xenon gas
PDB Compounds: (D:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fzhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzhd_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1fzhd_:

Click to download the PDB-style file with coordinates for d1fzhd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzhd_: