SCOPe 2.08: Domain d1fzhd_: 1fzh D:

Lineage for d1fzhd_ (1fzh D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)

8. Domain d1fzhd_: 1fzh D: [60137]
   Other proteins in same PDB: d1fzha_, d1fzhb_, d1fzhe_, d1fzhf_
   complexed with ca, fe, xe
   has additional insertions and/or extensions that are not grouped together

Details for d1fzhd_

PDB Entry: 1fzh, 2.6 Å

PDB Description: methane monooxygenase hydroxylase, form ii pressurized with xenon gas

PDB Compounds: (D:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fzhd_:

Sequence; same for both SEQRES and ATOM records:

>d1fzhd_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

Timeline for d1fzhd_:

• d1fzhd_ first appeared in SCOP 1.57
  
• d1fzhd_ appears in SCOPe 2.07