Lineage for d1fz9c_ (1fz9 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991094Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1991179Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 1991180Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 1991219Domain d1fz9c_: 1fz9 C: [60130]
    Other proteins in same PDB: d1fz9a_, d1fz9b_, d1fz9e_, d1fz9f_
    complexed with ca, eti, fe

Details for d1fz9c_

PDB Entry: 1fz9 (more details), 2.3 Å

PDB Description: Methane monooxygenase hydroxylase, form II cocrystallized with iodoethane
PDB Compounds: (C:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fz9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz9c_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1fz9c_:

Click to download the PDB-style file with coordinates for d1fz9c_.
(The format of our PDB-style files is described here.)

Timeline for d1fz9c_: