Lineage for d1fz9c_ (1fz9 C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536385Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 536448Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 536449Species Methylococcus capsulatus [TaxId:414] [88793] (15 PDB entries)
  8. 536470Domain d1fz9c_: 1fz9 C: [60130]
    Other proteins in same PDB: d1fz9a_, d1fz9b_, d1fz9e_, d1fz9f_

Details for d1fz9c_

PDB Entry: 1fz9 (more details), 2.3 Å

PDB Description: Methane monooxygenase hydroxylase, form II cocrystallized with iodoethane

SCOP Domain Sequences for d1fz9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz9c_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1fz9c_:

Click to download the PDB-style file with coordinates for d1fz9c_.
(The format of our PDB-style files is described here.)

Timeline for d1fz9c_: