Lineage for d1fz6b_ (1fz6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990053Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 1990054Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries)
  8. 1990082Domain d1fz6b_: 1fz6 B: [60117]
    Other proteins in same PDB: d1fz6c_, d1fz6d_, d1fz6e_, d1fz6f_
    complexed with ca, fe, moh

Details for d1fz6b_

PDB Entry: 1fz6 (more details), 2.05 Å

PDB Description: methane monooxygenase hydroxylase, form ii soaked in 1 m methanol
PDB Compounds: (B:) methane monooxygenase component a, alpha chain

SCOPe Domain Sequences for d1fz6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz6b_ a.25.1.2 (B:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]}
raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
qphvrgdklwtlddikrlncvfknpvkafn

SCOPe Domain Coordinates for d1fz6b_:

Click to download the PDB-style file with coordinates for d1fz6b_.
(The format of our PDB-style files is described here.)

Timeline for d1fz6b_: