Lineage for d1fyja_ (1fyj A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46191Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 46192Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 46219Family a.16.1.3: a tRNA synthase domain [47068] (1 protein)
  6. 46220Protein Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element [47069] (2 species)
  7. 46224Species Human (Homo sapiens) [TaxId:9606] [63499] (1 PDB entry)
  8. 46225Domain d1fyja_: 1fyj A: [60115]

Details for d1fyja_

PDB Entry: 1fyj (more details)

PDB Description: solution structure of multi-functional peptide motif-1 present in human glutamyl-prolyl trna synthetase (eprs).

SCOP Domain Sequences for d1fyja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyja_ a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Human (Homo sapiens)}
dslvlynrvavqgdvvrelkakkapkedvdaavkqllslkaeykektgqeykpgnpp

SCOP Domain Coordinates for d1fyja_:

Click to download the PDB-style file with coordinates for d1fyja_.
(The format of our PDB-style files is described here.)

Timeline for d1fyja_: