SCOPe 2.05: Domain d1fxqb_: 1fxq B:

Lineage for d1fxqb_ (1fxq B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)

6. Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species)

7. Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries)

8. Domain d1fxqb_: 1fxq B: [60109]
   complexed with a5p, pep

Details for d1fxqb_

PDB Entry: 1fxq, 1.8 Å

PDB Description: aquifex aeolicus kdo8p synthase in complex with pep and a5p

PDB Compounds: (B:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d1fxqb_:

Sequence; same for both SEQRES and ATOM records:

>d1fxqb_ c.1.10.4 (B:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
kflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley
gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgravn
vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd
athsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlplsq
legiieaileirevaskyyeti

Timeline for d1fxqb_:

• d1fxqb_ first appeared in SCOP 1.57
  
• d1fxqb_ appears in SCOPe 2.04
  
• d1fxqb_ appears in SCOPe 2.06
  
• d1fxqb_ appears in the current release, SCOPe 2.08