Lineage for d1fxqb_ (1fxq B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342981Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 1343058Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species)
  7. 1343059Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries)
  8. 1343087Domain d1fxqb_: 1fxq B: [60109]
    complexed with a5p, pep

Details for d1fxqb_

PDB Entry: 1fxq (more details), 1.8 Å

PDB Description: aquifex aeolicus kdo8p synthase in complex with pep and a5p
PDB Compounds: (B:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d1fxqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxqb_ c.1.10.4 (B:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
kflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley
gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgravn
vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd
athsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlplsq
legiieaileirevaskyyeti

SCOPe Domain Coordinates for d1fxqb_:

Click to download the PDB-style file with coordinates for d1fxqb_.
(The format of our PDB-style files is described here.)

Timeline for d1fxqb_: