Lineage for d1fxfa_ (1fxf A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2338847Protein Phospholipase A2 [48637] (5 species)
  7. 2338925Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (23 PDB entries)
  8. 2338931Domain d1fxfa_: 1fxf A: [60102]
    complexed with ca, mji, po4

Details for d1fxfa_

PDB Entry: 1fxf (more details), 1.85 Å

PDB Description: carboxylic ester hydrolase complex (dimeric pla2 + mj33 inhibitor + phosphate ions)
PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d1fxfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxfa_ a.133.1.2 (A:) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

SCOPe Domain Coordinates for d1fxfa_:

Click to download the PDB-style file with coordinates for d1fxfa_.
(The format of our PDB-style files is described here.)

Timeline for d1fxfa_: