SCOP 1.71: Domain d1fx9b_: 1fx9 B:

Lineage for d1fx9b_ (1fx9 B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Phospholipase A2 [48637] (4 species)

7. Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (13 PDB entries)

8. Domain d1fx9b_: 1fx9 B: [60101]
   complexed with ca, mji, so4

Details for d1fx9b_

PDB Entry: 1fx9, 2 Å

PDB Description: carboxylic ester hydrolase complex (dimeric pla2 + mj33 inhibitor + sulphate ions)

SCOP Domain Sequences for d1fx9b_:

Sequence; same for both SEQRES and ATOM records:

>d1fx9b_ a.133.1.2 (B:) Phospholipase A2 {Pig (Sus scrofa), pancreas}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

Timeline for d1fx9b_:

• d1fx9b_ first appeared in SCOP 1.57
  
• d1fx9b_ appears in SCOP 1.69
  
• d1fx9b_ appears in SCOP 1.73
  
• d1fx9b_ appears in the current release, SCOPe 2.08