SCOP 1.57: Domain d1fx7d2: 1fx7 D:65-140

Lineage for d1fx7d2 (1fx7 D:65-140)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)

4. Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)

6. Protein Iron-dependent regulator [47983] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [47984] (2 PDB entries)

8. Domain d1fx7d2: 1fx7 D:65-140 [60098]
   Other proteins in same PDB: d1fx7a1, d1fx7a3, d1fx7b1, d1fx7b3, d1fx7c1, d1fx7c3, d1fx7d1, d1fx7d3

Details for d1fx7d2

PDB Entry: 1fx7, 2 Å

PDB Description: crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis

SCOP Domain Sequences for d1fx7d2:

Sequence; same for both SEQRES and ATOM records:

>d1fx7d2 a.76.1.1 (D:65-140) Iron-dependent regulator {Mycobacterium tuberculosis}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipgldelgv

Timeline for d1fx7d2:

• d1fx7d2 is new in SCOP 1.57
  
• d1fx7d2 appears in SCOP 1.59
  
• d1fx7d2 appears in the current release, SCOPe 2.08