![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins) |
![]() | Protein Iron-dependent regulator IdeR [46885] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries) Uniprot Q50495 |
![]() | Domain d1fx7d1: 1fx7 D:1-64 [60097] Other proteins in same PDB: d1fx7a2, d1fx7a3, d1fx7b2, d1fx7b3, d1fx7c2, d1fx7c3, d1fx7d2, d1fx7d3 complexed with co, so4 |
PDB Entry: 1fx7 (more details), 2 Å
SCOP Domain Sequences for d1fx7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx7d1 a.4.5.24 (D:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr hlel
Timeline for d1fx7d1: