![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
![]() | Protein Iron-dependent regulator [47983] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries) Uniprot Q50495 |
![]() | Domain d1fx7b2: 1fx7 B:65-140 [60092] Other proteins in same PDB: d1fx7a1, d1fx7a3, d1fx7b1, d1fx7b3, d1fx7c1, d1fx7c3, d1fx7d1, d1fx7d3 complexed with co, so4 |
PDB Entry: 1fx7 (more details), 2 Å
SCOPe Domain Sequences for d1fx7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx7b2 a.76.1.1 (B:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]} tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt tspfgnpipgldelgv
Timeline for d1fx7b2: