SCOPe 2.06: Domain d1fx0b3: 1fx0 B:98-377

Lineage for d1fx0b3 (1fx0 B:98-377)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88783] (2 PDB entries)

8. Domain d1fx0b3: 1fx0 B:98-377 [60085]
   Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0a3, d1fx0b1, d1fx0b2

Details for d1fx0b3

PDB Entry: 1fx0, 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

PDB Compounds: (B:) ATP synthase beta chain

SCOPe Domain Sequences for d1fx0b3:

Sequence; same for both SEQRES and ATOM records:

>d1fx0b3 c.37.1.11 (B:98-377) Central domain of beta subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
lsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapaftqldtklsifetgikvvn
llapyrrggkiglfggagvgktvlimelinniakahggvsvfggvgertregndlymemk
esgvineqniaeskvalvygqmneppgarmrvgltaltmaeyfrdvneqdvllfidnifr
fvqagsevsallgrmpsavgyqptlstemgslqeritstkegsitsiqavyvpaddltdp
apattfahldattvlsrglaakgiypavdpldststmlqp

Timeline for d1fx0b3:

• d1fx0b3 first appeared in SCOP 1.57
  
• d1fx0b3 appears in SCOPe 2.05
  
• d1fx0b3 appears in SCOPe 2.07
  
• d1fx0b3 appears in the current release, SCOPe 2.08