Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins) |
Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [64024] (2 PDB entries) |
Domain d1fx0b3: 1fx0 B:98-377 [60085] Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0b1, d1fx0b2 |
PDB Entry: 1fx0 (more details), 3.2 Å
SCOP Domain Sequences for d1fx0b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx0b3 c.37.1.11 (B:98-377) Central domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast} lsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapaftqldtklsifetgikvvn llapyrrggkiglfggagvgktvlimelinniakahggvsvfggvgertregndlymemk esgvineqniaeskvalvygqmneppgarmrvgltaltmaeyfrdvneqdvllfidnifr fvqagsevsallgrmpsavgyqptlstemgslqeritstkegsitsiqavyvpaddltdp apattfahldattvlsrglaakgiypavdpldststmlqp
Timeline for d1fx0b3: