SCOP 1.57: Domain d1fx0b3: 1fx0 B:98-377

Lineage for d1fx0b3 (1fx0 B:98-377)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)

6. Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [64024] (1 PDB entry)

8. Domain d1fx0b3: 1fx0 B:98-377 [60085]
   Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0b1, d1fx0b2

Details for d1fx0b3

PDB Entry: 1fx0, 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

SCOP Domain Sequences for d1fx0b3:

Sequence; same for both SEQRES and ATOM records:

>d1fx0b3 c.37.1.11 (B:98-377) Central domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
lsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapaftqldtklsifetgikvvn
llapyrrggkiglfggagvgktvlimelinniakahggvsvfggvgertregndlymemk
esgvineqniaeskvalvygqmneppgarmrvgltaltmaeyfrdvneqdvllfidnifr
fvqagsevsallgrmpsavgyqptlstemgslqeritstkegsitsiqavyvpaddltdp
apattfahldattvlsrglaakgiypavdpldststmlqp

Timeline for d1fx0b3:

• d1fx0b3 is new in SCOP 1.57
  
• d1fx0b3 appears in SCOP 1.59
  
• d1fx0b3 appears in the current release, SCOPe 2.08