Lineage for d1fx0b3 (1fx0 B:98-377)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2449972Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2450103Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)
  7. 2450218Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88783] (2 PDB entries)
  8. 2450219Domain d1fx0b3: 1fx0 B:98-377 [60085]
    Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0a3, d1fx0b1, d1fx0b2

Details for d1fx0b3

PDB Entry: 1fx0 (more details), 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach
PDB Compounds: (B:) ATP synthase beta chain

SCOPe Domain Sequences for d1fx0b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx0b3 c.37.1.11 (B:98-377) Central domain of beta subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
lsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapaftqldtklsifetgikvvn
llapyrrggkiglfggagvgktvlimelinniakahggvsvfggvgertregndlymemk
esgvineqniaeskvalvygqmneppgarmrvgltaltmaeyfrdvneqdvllfidnifr
fvqagsevsallgrmpsavgyqptlstemgslqeritstkegsitsiqavyvpaddltdp
apattfahldattvlsrglaakgiypavdpldststmlqp

SCOPe Domain Coordinates for d1fx0b3:

Click to download the PDB-style file with coordinates for d1fx0b3.
(The format of our PDB-style files is described here.)

Timeline for d1fx0b3: