Lineage for d1fx0b2 (1fx0 B:19-97)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671688Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 671689Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 671735Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 671784Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88681] (2 PDB entries)
  8. 671786Domain d1fx0b2: 1fx0 B:19-97 [60084]
    Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0a3, d1fx0b1, d1fx0b3

Details for d1fx0b2

PDB Entry: 1fx0 (more details), 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach
PDB Compounds: (B:) ATP synthase beta chain

SCOP Domain Sequences for d1fx0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava
msatdgltrgmevidtgap

SCOP Domain Coordinates for d1fx0b2:

Click to download the PDB-style file with coordinates for d1fx0b2.
(The format of our PDB-style files is described here.)

Timeline for d1fx0b2: