Class b: All beta proteins [48724] (111 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein) |
Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63793] (2 PDB entries) |
Domain d1fx0b2: 1fx0 B:19-97 [60084] Other proteins in same PDB: d1fx0a1, d1fx0a3, d1fx0b1, d1fx0b3 |
PDB Entry: 1fx0 (more details), 3.2 Å
SCOP Domain Sequences for d1fx0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx0b2 b.49.1.1 (B:19-97) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast} nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava msatdgltrgmevidtgap
Timeline for d1fx0b2: