![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species) |
![]() | Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88681] (2 PDB entries) |
![]() | Domain d1fx0b2: 1fx0 B:19-97 [60084] Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0a3, d1fx0b1, d1fx0b3 |
PDB Entry: 1fx0 (more details), 3.2 Å
SCOPe Domain Sequences for d1fx0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava msatdgltrgmevidtgap
Timeline for d1fx0b2: