SCOPe 2.07: Domain d1fx0b1: 1fx0 B:378-485

Lineage for d1fx0b1 (1fx0 B:378-485)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88932] (2 PDB entries)

8. Domain d1fx0b1: 1fx0 B:378-485 [60083]
   Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0a3, d1fx0b2, d1fx0b3

Details for d1fx0b1

PDB Entry: 1fx0, 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

PDB Compounds: (B:) ATP synthase beta chain

SCOPe Domain Sequences for d1fx0b1:

Sequence; same for both SEQRES and ATOM records:

>d1fx0b1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata

Timeline for d1fx0b1:

• d1fx0b1 first appeared in SCOP 1.57
  
• d1fx0b1 appears in SCOPe 2.06
  
• d1fx0b1 appears in the current release, SCOPe 2.08