SCOP 1.59: Domain d1fx0b1: 1fx0 B:378-485

Lineage for d1fx0b1 (1fx0 B:378-485)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63576] (1 PDB entry)

8. Domain d1fx0b1: 1fx0 B:378-485 [60083]
   Other proteins in same PDB: d1fx0a2, d1fx0a3, d1fx0b2, d1fx0b3

Details for d1fx0b1

PDB Entry: 1fx0, 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

SCOP Domain Sequences for d1fx0b1:

Sequence; same for both SEQRES and ATOM records:

>d1fx0b1 a.69.1.1 (B:378-485) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata

Timeline for d1fx0b1:

• d1fx0b1 first appeared in SCOP 1.57
  
• d1fx0b1 appears in SCOP 1.61
  
• d1fx0b1 appears in the current release, SCOPe 2.08