Class a: All alpha proteins [46456] (144 folds) |
Fold a.69: Left-handed superhelix [47916] (2 superfamilies) |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein) |
Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63576] (1 PDB entry) |
Domain d1fx0b1: 1fx0 B:378-485 [60083] Other proteins in same PDB: d1fx0a2, d1fx0a3, d1fx0b2, d1fx0b3 |
PDB Entry: 1fx0 (more details), 3.2 Å
SCOP Domain Sequences for d1fx0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx0b1 a.69.1.1 (B:378-485) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast} rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata
Timeline for d1fx0b1: