Lineage for d1fx0b1 (1fx0 B:378-485)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49089Fold a.69: Left-handed superhelix [47916] (2 superfamilies)
  4. 49090Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 49091Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 49092Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 49154Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63576] (1 PDB entry)
  8. 49156Domain d1fx0b1: 1fx0 B:378-485 [60083]
    Other proteins in same PDB: d1fx0a2, d1fx0a3, d1fx0b2, d1fx0b3

Details for d1fx0b1

PDB Entry: 1fx0 (more details), 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

SCOP Domain Sequences for d1fx0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx0b1 a.69.1.1 (B:378-485) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata

SCOP Domain Coordinates for d1fx0b1:

Click to download the PDB-style file with coordinates for d1fx0b1.
(The format of our PDB-style files is described here.)

Timeline for d1fx0b1: