Lineage for d1fx0a3 (1fx0 A:97-372)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122391Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 122426Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 122488Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [64024] (1 PDB entry)
  8. 122489Domain d1fx0a3: 1fx0 A:97-372 [60082]
    Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0b1, d1fx0b2

Details for d1fx0a3

PDB Entry: 1fx0 (more details), 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

SCOP Domain Sequences for d1fx0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
qipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaida
mipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqer
gameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqmsl
llrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnvi
sitdgqiflsadlfnagirpainvgisvsrvgsaaq

SCOP Domain Coordinates for d1fx0a3:

Click to download the PDB-style file with coordinates for d1fx0a3.
(The format of our PDB-style files is described here.)

Timeline for d1fx0a3: