SCOP 1.59: Domain d1fx0a2: 1fx0 A:25-96

Lineage for d1fx0a2 (1fx0 A:25-96)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63793] (1 PDB entry)

8. Domain d1fx0a2: 1fx0 A:25-96 [60081]
   Other proteins in same PDB: d1fx0a1, d1fx0a3, d1fx0b1, d1fx0b3

Details for d1fx0a2

PDB Entry: 1fx0, 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

SCOP Domain Sequences for d1fx0a2:

Sequence; same for both SEQRES and ATOM records:

>d1fx0a2 b.49.1.1 (A:25-96) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
egssvkatgria

Timeline for d1fx0a2:

• d1fx0a2 first appeared in SCOP 1.57
  
• d1fx0a2 appears in SCOP 1.61
  
• d1fx0a2 appears in the current release, SCOPe 2.08