Lineage for d1fx0a2 (1fx0 A:25-96)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 112456Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 112457Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 112458Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 112459Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 112521Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63793] (1 PDB entry)
  8. 112522Domain d1fx0a2: 1fx0 A:25-96 [60081]
    Other proteins in same PDB: d1fx0a1, d1fx0a3, d1fx0b1, d1fx0b3

Details for d1fx0a2

PDB Entry: 1fx0 (more details), 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

SCOP Domain Sequences for d1fx0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx0a2 b.49.1.1 (A:25-96) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
egssvkatgria

SCOP Domain Coordinates for d1fx0a2:

Click to download the PDB-style file with coordinates for d1fx0a2.
(The format of our PDB-style files is described here.)

Timeline for d1fx0a2: